PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919872.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 377aa    MW: 42672 Da    PI: 5.6549
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919872.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.77.7e-5251321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd+elv +yLkkkv+g k++l evi+ +++yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+sgyWkatg+d++++
  XP_010919872.1   5 LPPGFRFHPTDDELVGYYLKKKVDGIKFDL-EVIPLIELYKFDPWELPdKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATASGYWKATGRDRKII 98 
                     79****************************.99**************96434556788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++ gl+ktLvfy+grap ge+tdWvmheyrl
  XP_010919872.1  99 C-ESSVHGLRKTLVFYRGRAPGGERTDWVMHEYRL 132
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-593154IPR003441NAC domain
PROSITE profilePS5100555.9845155IPR003441NAC domain
PfamPF023657.5E-296132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MSLSLPPGFR FHPTDDELVG YYLKKKVDGI KFDLEVIPLI ELYKFDPWEL PDKSFLPKRD  60
MEWFFFCPRD RKYPNGSRTN RATASGYWKA TGRDRKIICE SSVHGLRKTL VFYRGRAPGG  120
ERTDWVMHEY RLCEYRSDGS SNFVGAFSLC HIVKRHDHGQ KIGDLQGESR ARKGHSSAMT  180
DFSPKMCFSN VLSTSEENQS VVIDLNRSNG STRSNSLENL RGNELHQIMI DSDQTDLCRS  240
RVVSDASKVS SPKEGISESM ITNVFPSSIE ICTPCNPSPF SSCENFREEA YMIDELNGHG  300
CSSSCPSPVY CMDMFSSVED ITLQSLEWDT PKYMNASSSV AGIETWNPVF PPPICRQASV  360
GEEVNLWFQD DSMVIVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-55216117174NAC domain-containing protein 19
3swm_B3e-55216117174NAC domain-containing protein 19
3swm_C3e-55216117174NAC domain-containing protein 19
3swm_D3e-55216117174NAC domain-containing protein 19
3swp_A3e-55216117174NAC domain-containing protein 19
3swp_B3e-55216117174NAC domain-containing protein 19
3swp_C3e-55216117174NAC domain-containing protein 19
3swp_D3e-55216117174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919872.10.0PREDICTED: NAC domain-containing protein 72-like isoform X1
RefseqXP_010919873.10.0PREDICTED: NAC domain-containing protein 72-like isoform X1
TrEMBLM0RT581e-133M0RT58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17780_0011e-132(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-81NAC domain containing protein 71